Rabbit Polyclonal Anti-ENTPD5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ENTPD5 |
Rabbit Polyclonal Anti-ENTPD5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ENTPD5 |
Rabbit Polyclonal Anti-ENTPD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ENTPD1 |
NT5E Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NT5E |
Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))
Applications | IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6 |
Rabbit polyclonal antibody to ENTPD5(CD39L4) (ectonucleoside triphosphate diphosphohydrolase 5)
Applications | IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 191 of ENTPD5 (Uniprot ID#O75356) |
Rabbit polyclonal antibody to ENTPD3 (ectonucleoside triphosphate diphosphohydrolase 3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 200 and 459 of ENTPD3 (Uniprot ID#O75355) |
Rabbit Polyclonal Anti-DHODH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHODH antibody: synthetic peptide directed towards the C terminal of human DHODH. Synthetic peptide located within the following region: GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS |
Rabbit Polyclonal Anti-ENTPD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ENTPD1 antibody: synthetic peptide directed towards the N terminal of human ENTPD1. Synthetic peptide located within the following region: AREVIPRSQHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPF |
Rabbit polyclonal anti-RRM2B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RRM2B. |
Rabbit polyclonal RRM2B p53R2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-Human RRM2B/p53R2 antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human RRM2B1 protein. A residue of cysteine was added to facilitate coupling. |
Rabbit Polyclonal Anti-DHODH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHODH antibody: synthetic peptide directed towards the N terminal of human DHODH. Synthetic peptide located within the following region: FGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLR |
Rabbit Polyclonal Anti-DHODH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHODH antibody: synthetic peptide directed towards the middle region of human DHODH. Synthetic peptide located within the following region: NLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL |
Rabbit polyclonal anti-NT5E antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NT5E. |
Rabbit Polyclonal Anti-NT5C3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII |
Rabbit Polyclonal Anti-ENTPD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENTPD6 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENTPD6. Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP |