USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
USD 471.00
In Stock
USD 471.00
In Stock
USD 471.00
In Stock
Rabbit Polyclonal Anti-GAA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL |
Rabbit polyclonal anti-B4GALT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human B4GALT1. |
USD 198.00
2 Days
G6PC Rabbit monoclonal antibody,clone OTIR4H3
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 198.00
2 Days
G6PC Rabbit monoclonal antibody,clone OTIR5G10
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 198.00
2 Days
G6PC Rabbit monoclonal antibody,clone OTIR2H10
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-B4GALT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH |
Rabbit Polyclonal Anti-B4GALT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD |
Rabbit Polyclonal Anti-B4GALT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR |
Germany
Japan
United Kingdom
China
