Antibodies

Jump to Filters
View as table Download
STIP1 Rabbit Polyclonal Antibody
TA308465

USD 625.00

In Stock

Rabbit Polyclonal antibody to STIP1 (stress-induced-phosphoprotein 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 300 of STIP1 (Uniprot ID#P31948)
STIP1 Rabbit Polyclonal Antibody
TA324736

USD 580.00

5 Days

Rabbit polyclonal STIP1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Hamster)
Conjugation Unconjugated
Immunogen This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human STIP1.
STIP1 Rabbit Polyclonal Antibody
TA324735

USD 580.00

5 Days

Rabbit polyclonal STIP1 Antibody (C-term)

Applications FC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine, Hamster, Monkey)
Conjugation Unconjugated
Immunogen This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 461-488 amino acids from the C-terminal region of human STIP1.
STIP1 Rabbit Polyclonal Antibody
TA339303

USD 485.00

5 Days

Rabbit Polyclonal Anti-STIP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the C terminal of human STIP1. Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS
Prion protein PrP (PRNP) Rabbit Polyclonal Antibody
TA590315

USD 482.00

In Stock

Rabbit Polyclonal Prion protein Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
STIP1 Rabbit Polyclonal Antibody
TA339302

USD 485.00

5 Days

Rabbit Polyclonal Anti-STIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the N terminal of human STIP1. Synthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM
Prion protein PrP (PRNP) Rabbit Polyclonal Antibody
TA343277

USD 539.00

5 Days

Rabbit Polyclonal Anti-PRNP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Prnp antibody is: synthetic peptide directed towards the middle region of Mouse Prnp. Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF