Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-CYB5R3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CYB5R3 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CYB5R3 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Conjugation | Unconjugated |
| Immunogen | Diaphorase isolated and purified from porcine heart. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
CYB5R3 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Conjugation | Biotin |
| Immunogen | Diaphorase isolated and purified from porcine heart. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
CYB5R3 Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 125-334 of human CYB5R3 (NP_001165131.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-CYB5R3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYB5R3 antibody: synthetic peptide directed towards the C terminal of human CYB5R3. Synthetic peptide located within the following region: IRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- CYB5R3
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal