Antibodies

Jump to Filters
View as table Download
RHEB Rabbit Polyclonal Antibody
TA351443

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-RHEB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RHEB
RHEB Rabbit Polyclonal Antibody
TA322575

USD 380.00

In Stock

Anti-RHEB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 150-162 amino acids of Human Ras homolog enriched in brain
RHEB Rabbit Polyclonal Antibody
TA322576

USD 380.00

In Stock

Anti-RHEB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 150-162 amino acids of Human Ras homolog enriched in brain
RHEB Rabbit Polyclonal Antibody
TA350350

USD 380.00

In Stock

Rabbit Polyclonal Anti-RHEB Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RHEB
RHEB (C-term) Rabbit Polyclonal Antibody
AP53656PU-N

USD 580.00

2 Weeks

RHEB (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 104-134 amino acids from the C-terminal region of Human RHEB.
RHEB Rabbit Polyclonal Antibody
TA326964

USD 365.00

3 Weeks

RHEB Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RHEB
RHEB Rabbit Polyclonal Antibody
TA342253

USD 539.00

5 Days

Rabbit polyclonal Anti-RHEB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHEB antibody: synthetic peptide directed towards the middle region of human RHEB. Synthetic peptide located within the following region: VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA