Antibodies

Jump to Filters
View as table Download
FADS1 Rabbit Polyclonal Antibody
TA349954

USD 380.00

In Stock

Rabbit Polyclonal Anti-FADS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FADS1
ACOX1 Rabbit Polyclonal Antibody
TA324048

USD 380.00

In Stock

Anti-ACOX1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA oxidase 1, palmitoyl
HSD17B12 Rabbit Polyclonal Antibody
TA350058

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-HSD17B12 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HSD17B12
ACAA1 Rabbit Polyclonal Antibody
TA346554

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACAA1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD
acyl CoA Thioesterase 2 (ACOT2) Rabbit Polyclonal Antibody
TA322466

USD 380.00

In Stock

Anti-ACOT2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 169-468 amino acids of human acyl-CoA thioesterase 2
HADHA Rabbit Polyclonal Antibody
TA332625

USD 450.00

3 Weeks

Rabbit anti-HADHA Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HADHA
YOD1 Rabbit Polyclonal Antibody
TA315586

USD 380.00

In Stock

Rabbit polyclonal anti-YOD1 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human YOD1.