Antibodies

Jump to Filters
View as table Download
GPR183 Rabbit Polyclonal Antibody
TA316825

USD 515.00

2 Weeks

GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human (Predicted: Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit)
Conjugation Unconjugated
Immunogen GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%).
GPR183 Rabbit Polyclonal Antibody
TA331259

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR183 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR183 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR183. Synthetic peptide located within the following region: SLPWILLGACFIGYVLPLIIILICYSQICCKLFRTAKQNPLTEKSGVNKK