Rabbit Polyclonal antibody to CTDSP2 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2)
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 26 and 271 of CTDSP2 (Uniprot ID#O14595) |
Rabbit Polyclonal Anti-CTDSP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTDSP2 antibody: synthetic peptide directed towards the N terminal of human CTDSP2. Synthetic peptide located within the following region: MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV |
Rabbit Polyclonal Anti-CTDSP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTDSP2 antibody: synthetic peptide directed towards the middle region of human CTDSP2. Synthetic peptide located within the following region: ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA |
Germany
Japan
United Kingdom
China
