CTDSP2 Rabbit Polyclonal Antibody

CAT#: TA340072

Rabbit Polyclonal Anti-CTDSP2 Antibody

Product Images

WB Suggested Anti-CTDSP2 Antibody Titration: 0.2-1 ug/ml; Positive Control: RPMI 8226 cell lysate.CTDSP2 is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CTDSP2 antibody: synthetic peptide directed towards the middle region of human CTDSP2. Synthetic peptide located within the following region: ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: CTD small phosphatase 2
• Database Link:
  NP_005721
  Entrez Gene 10106 Human
  UniProt ID O14595
• Background: CTDSP2 preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A.CTDSP2 negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. CTDSP2 is recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.CTDSP2 may contribute to the development of sarcomas.
• Synonyms: OS4; PSR2; SCP2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 93%; Rabbit: 91%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Phosphatase