Rabbit Polyclonal Anti-PARP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PARP3 |
Rabbit Polyclonal Anti-PARP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PARP3 |
Rabbit Polyclonal Anti-PARP3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PARP3 |
Rabbit Polyclonal Anti-PARP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PARP3 antibody: synthetic peptide directed towards the C terminal of human PARP3. Synthetic peptide located within the following region: LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP |
Rabbit polyclonal anti-PARP3 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PARP3. |
Rabbit polyclonal PARP3 Antibody (N-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PARP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 99-126 amino acids from the N-terminal region of human PARP3. |