Antibodies

Jump to Filters
View as table Download
Frizzled 2 (FZD2) Rabbit Polyclonal Antibody
TA313900

USD 380.00

In Stock

Rabbit polyclonal anti-FZD2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD2.
Frizzled 2 (FZD2) Rabbit Polyclonal Antibody
TA321353

USD 380.00

In Stock

Anti-FZD2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 188-190 amino acids of human led family receptor 2
Frizzled 2 (FZD2) Rabbit Polyclonal Antibody
TA344058

USD 539.00

5 Days

Rabbit Polyclonal Anti-FZD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD2 antibody: synthetic peptide directed towards the N terminal of human FZD2. Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI