Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-GLI2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Xenopus, Dog, Chimpanzee, Chicken, Quail |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit polyclonal DVL1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1. |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP |
Active filters
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- ES Cell Differentiation/IPS
Pathways
- Basal cell carcinoma