Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal GABARAP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region of the human GABARAP protein (within residues 1-50). [Swiss-Prot O95166] |
Rabbit Polyclonal Anti-GABARAP
| Applications | WB |
| Reactivities | Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
Rabbit Polyclonal Anti-GABARAP
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV |
GABARAP Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GABARAP |
GABARAP rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- GABARAP
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Pathways
- Regulation of autophagy