Antibodies

Jump to Filters
View as table Download
Frizzled 9 (FZD9) Rabbit Polyclonal Antibody
TA314730

USD 380.00

2 Weeks

Rabbit polyclonal anti-FZD9 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9.
WNT5A Rabbit Polyclonal Antibody
TA329908

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WNT5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
Frizzled 2 (FZD2) Rabbit Polyclonal Antibody
TA313900

USD 380.00

In Stock

Rabbit polyclonal anti-FZD2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD2.
Smoothened (SMO) Rabbit Polyclonal Antibody
TA322573

USD 380.00

In Stock

Anti-SMO Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 772-787 amino acids of human smoothened, frizzled family receptor
TCF7L2 Rabbit Polyclonal Antibody
TA333645

USD 539.00

In Stock

Rabbit Polyclonal Anti-TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA334657

USD 539.00

5 Days

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
p53 (TP53) Rabbit Polyclonal Antibody
TA326166

USD 380.00

4 Weeks

Rabbit polyclonal p53 (Phospho-Ser15) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E).
Modifications Phospho-specific
DVL1 Rabbit Polyclonal Antibody
TA329899

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-DVL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the middle region of human DVL1. Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA313140

USD 380.00

In Stock

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications Phospho-specific
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA313134

USD 380.00

In Stock

Rabbit polyclonal Catenin-beta (Ab-489) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
APC Rabbit Polyclonal Antibody
TA590822

USD 482.00

In Stock

Rabbit Polyclonal APC Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.