NOTCH1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a sequence at the middle region of human NOTCH1 |
NOTCH1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a sequence at the middle region of human NOTCH1 |
PROX1 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Fish, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide corresponding to the Homeobox domain of Prox1. |
Rabbit Polyclonal GLUT1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human GLUT1. |
Rabbit Polyclonal Anti-WNT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2. Synthetic peptide located within the following region: GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR |
Rabbit Polyclonal Anti-Actin-pan Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |
Rabbit Polyclonal Anti-TGF beta1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta. |
Rabbit Polyclonal Anti-IGF1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IGF1 antibody: A synthesized peptide derived from human IGF1 |
Rabbit anti CD117 (kit) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998. |
GFAP rabbit polyclonal antibody, Purified
Applications | IF, IHC |
Reactivities | Bovine, Guinea Pig, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Purified Human GFAP. |