STAT6 Rabbit monoclonal antibody,clone UMAB300
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
STAT6 Rabbit monoclonal antibody,clone UMAB300
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
STAT6 Rabbit monoclonal antibody,clone UMAB300
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-STAT6 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM |
STAT6 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human STAT6 (NP_001171550.1). |
Modifications | Unmodified |
Rabbit polyclonal STAT6 (Ab-641) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human STAT6 around the phosphorylation site of Tyrosine 641. |
STAT6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around amino acids 639~643 (R-G-Y-V-P) derived from Human STAT6. |
STAT6 pThr645 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
STAT6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 610-660 of Human Stat6. |
STAT6 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human STAT6 |
STAT6 pTyr641 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
STAT6 pTyr641 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human STAT6 around the phosphorylation site of Tyrosine 641 (R-G-YP-V-P). |
STAT6 pTyr641 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human STAT6 around the phosphorylation site of Tyrosine 641 (R-G-YP-V-P). |
STAT6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around amino acids 639~643 (R-G-Y-V-P) derived from Human STAT6. |
STAT6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human STAT6 around the phosphorylation site of threonine 645 (P-A-TP-I-K). |
STAT6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human STAT6 around the phosphorylation site of threonine 645 (P-A-TP-I-K). |