Germany
Japan
United Kingdom
China
Histidine decarboxylase (HDC) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Canine, Guinea Pig, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Histidine Decarboxylase produced in E.coli. |
Antibodies
View as table DownloadRabbit Polyclonal HIF-1 alpha Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3. |
Rabbit polyclonal antibody to NQO1 (NAD(P)H dehydrogenase, quinone 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Pig, Bovine, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 213 and 274 of NQO1 (Uniprot ID#P15559) |
USD 515.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Gibbon, Orang-Utan (Predicted: Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Rabbit Polyclonal antibody to beta Actin (actin, beta)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Dog, Rabbit, Chicken, Sheep, Chimpanzee, Bovine, Guinea Pig, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Porcine, Monkey, Rabbit, Sheep, Xenopus, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Xenopus, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Mouse, Bat, Zebrafish, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
5HT7 Receptor (HTR7) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Bovine, Bat, Canine, Equine, Guinea Pig, Hamster, Monkey, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic 20 amino acid peptide from C-terminal region of Human HTR7 / 5-HT7 |
Active filters
Category
- Antibodies
Reactivities
- Guinea Pig
Antibody Hosts
- Rabbit
Filter by
Target Symbol
- GFAP (6)
- GCG (5)
- CALNEXIN (3)
- GLG1 (2)
- HRH3 (2)
- PPARG (2)
- SNAP25 (2)
- SOD2 (2)
- 5 HT1F (1)
- ACTIN (1)
- AE2 (1)
- ALB (1)
- ALPHA 1A ADRENERGIC RECEPTOR (1)
- ATP1B3 (1)
- AVIL (1)
- BETA ACTIN (1)
- CALRETICULIN (1)
- CASPASE 3 (1)
- CCKAR (1)
- CPN10 (1)
- CRLR (1)
- DCXR (1)
- DOPA DECARBOXYLASE (1)
- EAAT1 (1)
- EMA (1)
- FAM86A (1)
- FSH RECEPTOR (1)
- GIRK1 (1)
- GIRK2 (1)
- GJA1 (1)
- GPX4 (1)
- HDC (1)
- HIF-1 ALPHA (1)
- HSP40 (1)
- HSP70-1A (1)
- HTR5A (1)
- HTR7 (1)
- IAPP (1)
- KCNH2 (1)
- LPL (1)
- MUSCARINIC ACETYLCHOLINE RECEPTOR M3 (1)
- NEUROKININ 1 RECEPTOR (1)
- NEUROPEPTIDE Y (1)
- NOS1 (1)
- NQO1 (1)
- P38 (1)
- PRODYNORPHIN (1)
- PTBP1 (1)
- RAMP1 (1)
- RBPMS (1)
- RHOC (1)
- SYNTAXIN (1)
- TACR3 (1)
- TGM2 (1)
- TLR3 (1)
- TM9SF3 (1)
- TSPAN17 (1)
- VEGFA (1)
- WNT2 (1)
- WNT7A (1)
Applications
Isotypes
Clonalities
Recombinant
Assay Types
Families
- Druggable Genome (33)
- Transmembrane (27)
- ES Cell Differentiation/IPS (7)
- Secreted Protein (7)
- GPCR (6)
- Transcription Factors (4)
- Ion Channels: Potassium (3)
- Stem cell - Pluripotency (2)
- Adult stem cells (1)
- Cancer stem cells (1)
- Protease (1)
- Protein Kinase (1)
- Stem cell relevant signaling - Wnt Signaling pathway (1)
Pathways
- Neuroactive ligand-receptor interaction (9)
- Antigen processing and presentation (5)
- Pathways in cancer (5)
- Calcium signaling pathway (4)
- MAPK signaling pathway (3)
- Vascular smooth muscle contraction (3)
- Amyotrophic lateral sclerosis (ALS) (2)
- Basal cell carcinoma (2)
- Cell adhesion molecules (CAMs) (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Focal adhesion (2)
- Hedgehog signaling pathway (2)
- Huntington's disease (2)
- Leukocyte transendothelial migration (2)
- Melanogenesis (2)
- Metabolic pathways (2)
- Regulation of actin cytoskeleton (2)
- Renal cell carcinoma (2)
- Toll-like receptor signaling pathway (2)
- VEGF signaling pathway (2)
- Viral myocarditis (2)
- Wnt signaling pathway (2)
- mTOR signaling pathway (2)
- Adherens junction (1)
- Adipocytokine signaling pathway (1)
- Alzheimer's disease (1)
- Apoptosis (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Bladder cancer (1)
- Cardiac muscle contraction (1)
- Colorectal cancer (1)
- Cytokine-cytokine receptor interaction (1)
- Dilated cardiomyopathy (1)
- Endocytosis (1)
- Fc epsilon RI signaling pathway (1)
- GnRH signaling pathway (1)
- Histidine metabolism (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- NOD-like receptor signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Neurotrophin signaling pathway (1)
- Pancreatic cancer (1)
- Parkinson's disease (1)
- Pathogenic Escherichia coli infection (1)
- Pentose and glucuronate interconversions (1)
- Phenylalanine metabolism (1)
- Prion diseases (1)
- Progesterone-mediated oocyte maturation (1)
- RIG-I-like receptor signaling pathway (1)
- Spliceosome (1)
- T cell receptor signaling pathway (1)
- Tight junction (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- Vibrio cholerae infection (1)
- p53 signaling pathway (1)