Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal FDPS Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FDPS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 82-112 amino acids from the N-terminal region of human FDPS. |
Rabbit Polyclonal Anti-HMGCR Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HMGCR |
TA350050 is a possible alternative to TA323545.
Rabbit Polyclonal Anti-ACAT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR |
Rabbit polyclonal antibody to IDI1 (isopentenyl-diphosphate delta isomerase 1)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 173 of IDI1 (Uniprot ID#Q13907) |
Rabbit Polyclonal Anti-ACAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH |
Rabbit Polyclonal Anti-ACAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL |
Rabbit Polyclonal Anti-GGPS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GGPS1 antibody: synthetic peptide directed towards the middle region of human GGPS1. Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ |
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Pathways
- Terpenoid backbone biosynthesis