Rabbit Polyclonal Anti-ATG12 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATG12 |
Rabbit Polyclonal Anti-ATG12 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATG12 |
Rabbit Polyclonal ATG12 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATG12 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ATG12. |
Rabbit Polyclonal ATG12 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATG12 antibody was raised against a 15 amino acid peptide from near the center of human ATG12. |
Rabbit Polyclonal Anti-ATG12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ATG12 Antibody: synthetic peptide directed towards the middle region of human ATG12. Synthetic peptide located within the following region: KFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW |