Antibodies

View as table Download

Rabbit Polyclonal Anti-ATG12 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ATG12

Rabbit Polyclonal ATG12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG12 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ATG12.

Rabbit Polyclonal ATG12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG12 antibody was raised against a 15 amino acid peptide from near the center of human ATG12.

Rabbit Polyclonal Anti-ATG12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG12 Antibody: synthetic peptide directed towards the middle region of human ATG12. Synthetic peptide located within the following region: KFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW