Antibodies

Jump to Filters
View as table Download
Laminin (LAMA1) Rabbit Polyclonal Antibody
TA322579

USD 380.00

4 Weeks

Anti-LAMA1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1606-1620 amino acids of Human laminin, alpha 1
Laminin (LAMA1) Rabbit Polyclonal Antibody
TA322580

USD 380.00

4 Weeks

Anti-LAMA1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1606-1620 amino acids of Human laminin, alpha 1
Laminin (LAMA1) Rabbit Polyclonal Antibody
TA316312

USD 380.00

In Stock

Rabbit polyclonal anti-LAMA1 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMA1.
Laminin (LAMC3) Rabbit Polyclonal Antibody
TA315044

USD 380.00

In Stock

Rabbit polyclonal anti-LAMC3 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMC3.
Laminin (LAMC3) Rabbit Polyclonal Antibody
TA338136

USD 539.00

5 Days

Rabbit Polyclonal Anti-LAMC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMC3 antibody is: synthetic peptide directed towards the C-terminal region of Human LAMC3. Synthetic peptide located within the following region: ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLT