Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ASS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASS antibody: synthetic peptide directed towards the C terminal of human ASS. Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE |
Rabbit Polyclonal Anti-ASS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASS antibody: synthetic peptide directed towards the N terminal of human ASS. Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF |
ASS1 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ASS |
Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 155 and 412 of ASS1 (Uniprot ID#P00966) |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- ASS1
Reactivities
- Human
Antibody Hosts
- Rabbit
Pathways
- Metabolic pathways