Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-HMGB1 Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | HMGB1 antibody was raised against a 19 amino acid peptide near the center of human HMGB1. |
Antibodies
View as table Download
Rabbit anti-PARP1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PARP1 |
Rabbit Polyclonal UNG Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | This antibody was generated by immunizing rabbit with a synthetic peptide sequence CRHFSKTNELLQKSGKKP corresponding to amino acids 281-298 of human UNG1 (NP 003353.1) and amino acids 290-307 of human UNG2 (NP 550433.1). The peptide sequence used for imm |
Rabbit polyclonal anti-SMUG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SMUG1 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-PARP2 Antibody
| Applications | IF, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Antibody Hosts
- Rabbit
Pathways
- Base excision repair