Antibodies

Jump to Filters
View as table Download
RAP1B Rabbit Polyclonal Antibody
TA323458

USD 380.00

In Stock

Anti-RAP1B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
RAP1B Rabbit Polyclonal Antibody
TA323457

USD 380.00

In Stock

Anti-RAP1B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
RAP1B Rabbit Polyclonal Antibody
TA380705

USD 365.00

3 Weeks

Rap1B Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human Rap1B (NP_056461.1).
Modifications Unmodified
RAP1A Rabbit Monoclonal Antibody [Clone ID: R03-7H8]
TA385129

USD 380.00

4 Weeks

RAP1 Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RAP1B Rabbit Polyclonal Antibody
TA336122

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAP1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAP1B Antibody: synthetic peptide directed towards the N terminal of human RAP1B. Synthetic peptide located within the following region: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ