Rabbit Polyclonal Anti-ACCN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACCN1 antibody: synthetic peptide directed towards the middle region of human ACCN1. Synthetic peptide located within the following region: LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA |
Rabbit Polyclonal Anti-Bnc1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Bnc1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI |
Rabbit Polyclonal Anti-ACCN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACCN1 antibody: synthetic peptide directed towards the C terminal of human ACCN1. Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV |
Germany
Japan
United Kingdom
China