Antibodies

Jump to Filters
View as table Download
DGAT1 Rabbit Polyclonal Antibody
TA351137

USD 380.00

In Stock

Rabbit Polyclonal Anti-DGAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DGAT1
DGAT1 Rabbit Polyclonal Antibody
TA343309

USD 539.00

5 Days

Rabbit Polyclonal Anti-DGAT1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dgat1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dgat1. Synthetic peptide located within the following region: HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI