OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DGAT1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA343309
Rabbit Polyclonal Anti-DGAT1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY402142 Transient overexpression lysate of diacylglycerol O-acyltransferase homolog 1 (mouse) (DGAT1) (as WB positive control) 100 ug
$436.00

View other "DGAT1 or NM_012079" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Dgat1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dgat1. Synthetic peptide located within the following region: HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 57 kDa
Gene Name diacylglycerol O-acyltransferase 1
Database Link
Background Dgat1 catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. It may be involved in VLDL (very low density lipoprotein) assembly. In liver, Dgat1 plays a role in esterifying exogenous fatty acids to glycerol. It functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Synonyms ARAT; ARGP1; DGAT; DIAR7
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93%; Zebrafish: 86%
Reference Data
Protein Categories Membrane Proteins
Protein Families Transmembrane
Protein Pathways Glycerolipid metabolism, Metabolic pathways, Retinol metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products