DGAT1 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of diacylglycerol O-acyltransferase homolog 1 (mouse) (DGAT1)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "DGAT1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Dgat1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dgat1. Synthetic peptide located within the following region: HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 57 kDa |
Gene Name | diacylglycerol O-acyltransferase 1 |
Database Link | |
Background | Dgat1 catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. It may be involved in VLDL (very low density lipoprotein) assembly. In liver, Dgat1 plays a role in esterifying exogenous fatty acids to glycerol. It functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders. |
Synonyms | ARAT; ARGP1; DGAT; DIAR7 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93%; Zebrafish: 86% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Glycerolipid metabolism, Metabolic pathways, Retinol metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.