Antibodies

View as table Download

SKP2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen synthetic peptide corresponding to a sequence at the N-terminal of human SKP2

Rabbit polyclonal SKP2 Antibody (Center)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SKP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 156-185 amino acids from the Central region of human SKP2.

Rabbit Polyclonal anti-SKP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SKP2 antibody is: synthetic peptide directed towards the C-terminal region of Human SKP2. Synthetic peptide located within the following region: TLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Rabbit Polyclonal Anti-SKP2/p45 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SKP2/p45 Antibody: A synthesized peptide derived from human SKP2/p45