Antibodies

View as table Download

T1R1 / TAS1R1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bovine, Dog, Gorilla, Human, Pig, Gibbon, Horse (Predicted: Monkey, Mouse, Rat, Hamster, Rabbit)
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Cat, Dog, Elephant, Panda, Horse, Pig (100%); Marmoset, Mouse, Rat, Hamster, Rabbit

T1R1 / TAS1R1 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen T1R1 / TAS1R1 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Marmoset (83%).

Rabbit Polyclonal Anti-TAS1R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R1. Synthetic peptide located within the following region: NINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGT

Rabbit Polyclonal Anti-TAS1R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the middle region of Human TAS1R1. Synthetic peptide located within the following region: QKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSSNQLCRECQAFMAHTMP