Antibodies

Jump to Filters
View as table Download
RAP1B Rabbit Polyclonal Antibody
TA323458

USD 380.00

In Stock

Anti-RAP1B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
RAP1B Rabbit Polyclonal Antibody
TA323457

USD 380.00

In Stock

Anti-RAP1B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
RAP1B Rabbit Polyclonal Antibody
TA336122

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAP1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAP1B Antibody: synthetic peptide directed towards the N terminal of human RAP1B. Synthetic peptide located within the following region: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ