Antibodies

Jump to Filters
View as table Download
Junctional Adhesion Molecule 2 (JAM2) Rabbit Polyclonal Antibody
TA308335

USD 625.00

In Stock

Rabbit Polyclonal antibody to JAM-B (junctional adhesion molecule 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 294 of JAM-B (Uniprot ID#P57087)
Junctional Adhesion Molecule 2 (JAM2) Rabbit Polyclonal Antibody
TA338012

USD 539.00

5 Days

Rabbit Polyclonal Anti-JAM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JAM2 antibody is: synthetic peptide directed towards the middle region of Human JAM2. Synthetic peptide located within the following region: LVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR