Antibodies

Jump to Filters
View as table Download
MGST3 Rabbit Polyclonal Antibody
TA314194

USD 380.00

In Stock

Rabbit polyclonal anti-MGST3 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MGST3.
MGST3 Rabbit Polyclonal Antibody
TA342918

USD 539.00

5 Days

Rabbit Polyclonal Anti-MGST3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MGST3 antibody: synthetic peptide directed towards the N terminal of human MGST3. Synthetic peptide located within the following region: LAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFF