Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RFX5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RFX5 peptide corresponding to a region at amino acids 320 to 494 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Antibodies
View as table Download
RFX5 rabbit polyclonal antibody, Ig Fraction
| Applications | ELISA, EMSA, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RFX5 (C-terminal specific) peptide corresponding to a region near the N-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
RFX5 (N-term) rabbit polyclonal antibody, Ig Fraction
| Applications | ELISA, EMSA, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | RFX5 (N-terminal specific) peptide corresponding to a region near the N-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit Polyclonal Anti-RFX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFX5 antibody: synthetic peptide directed towards the N terminal of human RFX5. Synthetic peptide located within the following region: MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGIL |
Rabbit Polyclonal Anti-RFX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFX5 antibody: synthetic peptide directed towards the C terminal of human RFX5. Synthetic peptide located within the following region: VIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP |
RFX5 rabbit polyclonal antibody, Serum
| Applications | ELISA, EMSA, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RFX5 (C-terminal specific) peptide corresponding to a region near the N-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
RFX5 rabbit polyclonal antibody, Serum
| Applications | ELISA, EMSA, IP |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | RFX5 peptide corresponding to amino acids 320 to 494 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
RFX5 (N-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, EMSA, IP |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | RFX5 (N-terminal specific) peptide corresponding to a region near the N-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Active filters
Category
- Antibodies
Target Symbol
- RFX5
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated