Antibodies

Jump to Filters
View as table Download
Histamine Rabbit Polyclonal Antibody
22939

USD 625.00

3 Days

Histamine rabbit polyclonal antibody

Applications IF, IHC
Reactivities Human, Insect, Rat
Conjugation Unconjugated
GABARAP Rabbit Polyclonal Antibody
TA339169

USD 539.00

5 Days

Rabbit Polyclonal Anti-GABARAP

Applications WB
Reactivities Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL