Antibodies

Jump to Filters
View as table Download
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 465.00

3 Weeks

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA336742

USD 550.00

2 Weeks

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]
Carboxypeptidase H (CPE) Rabbit Polyclonal Antibody
TA344338

USD 539.00

5 Days

Rabbit Polyclonal Anti-CPE Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
IL1 alpha (IL1A) Rabbit Polyclonal Antibody
TA349352

USD 380.00

In Stock

Rabbit Polyclonal Anti-IL1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IL1A
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA336738

USD 605.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]
IL1 beta (IL1B) Rabbit Polyclonal Antibody
AP20628PU-N

USD 465.00

3 Weeks

IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA323618

USD 380.00

In Stock

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor
LTA Rabbit Polyclonal Antibody
TA323619

USD 380.00

4 Weeks

Anti-LTA Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 36-205 amino acids of human lymphotoxin alpha (TNF superfamily, member 1)
Insulin (INS) Rabbit Polyclonal Antibody
TA350640

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-INS Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human INS
IL12A Rabbit Polyclonal Antibody
TA351939

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-IL12A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL12A
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA313322

USD 380.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.
Fas Ligand (FASLG) Rabbit Polyclonal Antibody
TA313465

USD 380.00

In Stock

Rabbit polyclonal FAS ligand antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FAS ligand.
Insulin (INS) Rabbit Polyclonal Antibody
TA347869

USD 380.00

In Stock

Rabbit Polyclonal Anti-Insulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin
LTA (Center) Rabbit Polyclonal Antibody
AP17540PU-N

USD 580.00

2 Weeks

LTA (Center) rabbit polyclonal antibody

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 46-72 amino acids from the Central region of Human LTA.
IL12B (C-term) Rabbit Polyclonal Antibody
AP52183PU-N

USD 580.00

2 Weeks

IL12B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 271-298aa) of human Interleukin-12 beta/IL12B.