Antibodies

Jump to Filters
View as table Download
GLB1 Rabbit Polyclonal Antibody
TA308238

USD 625.00

In Stock

Rabbit polyclonal antibody to beta-Gal (galactosidase, beta 1)

Applications IHC, WB
Reactivities Human (Predicted: Dog, Feline)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 166 and 677 of beta-Gal (Uniprot ID#P16278)
HEXB Rabbit Polyclonal Antibody
TA314004

USD 380.00

2 Weeks

Rabbit polyclonal anti-HEXB antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.
HEXA Rabbit Polyclonal Antibody
TA343107

USD 539.00

5 Days

Rabbit Polyclonal Anti-HEXA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV
GLB1 Rabbit Polyclonal Antibody
TA332449

USD 365.00

3 Weeks

Rabbit anti-GLB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLB1
B4GALNT1 Rabbit Polyclonal Antibody
TA313910

USD 380.00

2 Weeks

Rabbit polyclonal anti-B4GALNT1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B4GALNT1.
GLB1 Rabbit Polyclonal Antibody
TA313219

USD 380.00

4 Weeks

Rabbit polyclonal anti-GLB1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLB1.
HEXA Rabbit Polyclonal Antibody
TA332812

USD 365.00

3 Weeks

Rabbit anti-HEXA Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HEXA