Rabbit Polyclonal Anti-CIR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CIR1 antibody is: synthetic peptide directed towards the middle region of Human CIR1. Synthetic peptide located within the following region: GRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKK |
Rabbit Polyclonal Anti-CIR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CIR antibody: synthetic peptide directed towards the middle region of human CIR. Synthetic peptide located within the following region: SGFALKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLR |
Rabbit Polyclonal Anti-CIR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CIR antibody: synthetic peptide directed towards the C terminal of human CIR. Synthetic peptide located within the following region: RSRSPGSYKQRETRKRAQRNPGEEQSRRNDSRSHGTDLYRGEKMYREHPG |
Germany
Japan
United Kingdom
China