Antibodies

Jump to Filters
View as table Download
LIF Rabbit Polyclonal Antibody
TA321468

USD 380.00

2 Weeks

Anti-LIF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-47 amino acids of Human leukemia inhibitory factor
LIF Rabbit Polyclonal Antibody
TA319675

USD 570.00

5 Days

Rabbit Polyclonal LIF Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LIF antibody was raised against a 16 amino acid synthetic peptide near the center of human LIF.
LIF Rabbit Polyclonal Antibody
TA335060

USD 539.00

5 Days

Rabbit Polyclonal Anti-LIF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIF antibody: synthetic peptide directed towards the N terminal of human LIF. Synthetic peptide located within the following region: KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ