Antibodies

Jump to Filters
View as table Download
PDPK1 Rabbit Polyclonal Antibody
TA325772

USD 380.00

In Stock

Rabbit Polyclonal PDK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PDK1
PDPK1 Rabbit Polyclonal Antibody
TA325773

USD 380.00

2 Weeks

Rabbit Polyclonal PDK1 (Ser241) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PDK1 around the phosphorylation site of Serine 241
Modifications Phospho-specific
PDPK1 Rabbit Polyclonal Antibody
TA590136

USD 482.00

In Stock

Rabbit Polyclonal PDPK1 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
PDPK1 Rabbit Polyclonal Antibody
TA332418

USD 450.00

3 Weeks

Rabbit anti-PDPK1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human PDPK1
PDPK1 Rabbit Polyclonal Antibody
TA319161

USD 765.00

5 Days

Rabbit polyclonal anti-PDK1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminal of human PDK-1 protein.
PDPK1 Rabbit Polyclonal Antibody
TA329143

USD 539.00

5 Days

Rabbit Polyclonal anti-PDPK1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDPK1 antibody: synthetic peptide directed towards the middle region of human PDPK1. Synthetic peptide located within the following region: IIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVS
PDPK1 Rabbit Polyclonal Antibody
TA359698

USD 539.00

5 Days

PDPK1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PDPK1
PDPK1 Rabbit Polyclonal Antibody
TA312024

USD 380.00

4 Weeks

Rabbit polyclonal PDK1 (Tyr9) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PDK1 around the phosphorylation site of tyrosine 9 (Q-L-YP-D-A).
Modifications Phospho-specific