Rabbit Polyclonal Anti-ATP2A3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ATP2A3 |
Rabbit Polyclonal Anti-ATP2A3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ATP2A3 |
Rabbit Polyclonal Anti-ATP2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP2A3 antibody: synthetic peptide directed towards the middle region of human ATP2A3. Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS |