Antibodies

Jump to Filters
View as table Download
SERCA3 (ATP2A3) Rabbit Polyclonal Antibody
TA351651

USD 380.00

In Stock

Rabbit Polyclonal Anti-ATP2A3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATP2A3
SERCA3 (ATP2A3) Rabbit Polyclonal Antibody
TA339001

USD 539.00

5 Days

Rabbit Polyclonal Anti-ATP2A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP2A3 antibody: synthetic peptide directed towards the middle region of human ATP2A3. Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS