Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-COMT Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COMT antibody: synthetic peptide directed towards the middle region of human COMT. Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH |
TYR Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TYR |
AOC2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human AOC2 |
DBH Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DBH |
Rabbit anti-AOC3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AOC3 |
Rabbit Polyclonal Anti-Tyrp1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tyrp1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: AHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLEN |
Active filters
Category
- Antibodies
Reactivities
- Rat
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Transmembrane
Pathways
- Tyrosine metabolism