Antibodies

Jump to Filters
View as table Download
EXTL3 Rabbit Polyclonal Antibody
TA349949

USD 380.00

In Stock

Rabbit Polyclonal Anti-EXTL3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human EXTL3
EXTL1 Rabbit Polyclonal Antibody
TA351177

USD 380.00

In Stock

Rabbit Polyclonal Anti-EXTL1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EXTL1
HS3ST1 Rabbit Polyclonal Antibody
TA332073

USD 539.00

In Stock

Rabbit Polyclonal Anti-HS3ST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HS3ST1 Antibody: synthetic peptide directed towards the middle region of human HS3ST1. Synthetic peptide located within the following region: TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV