Antibodies

Jump to Filters
View as table Download
BCAS2 Rabbit Polyclonal Antibody
TA349703

USD 380.00

In Stock

Rabbit Polyclonal Anti-BCAS2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCAS2
CTNNBL1 Rabbit Polyclonal Antibody
TA349837

USD 380.00

In Stock

Rabbit Polyclonal Anti-CTNNBL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CTNNBL1
PPIL1 Rabbit Polyclonal Antibody
TA350297

USD 380.00

In Stock

Rabbit Polyclonal Anti-PPIL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
UAP56 (DDX39B) Rabbit Polyclonal Antibody
TA351881

USD 380.00

In Stock

Rabbit Polyclonal Anti-DDX39B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DDX39B
HNRPM (HNRNPM) Rabbit Polyclonal Antibody
TA351937

USD 380.00

In Stock

Rabbit Polyclonal Anti-HNRNPM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNRNPM
SART1 Rabbit Polyclonal Antibody
TA307946

USD 625.00

In Stock

Rabbit Polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 137 and 447 of SART1 (Uniprot ID#O43290)
hnRNP U (HNRNPU) Rabbit Polyclonal Antibody
TA345875

USD 539.00

In Stock

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the C terminal of human HNRNPU. Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF
Aly (ALYREF) Rabbit Polyclonal Antibody
TA322556

USD 380.00

In Stock

Anti-ALYREF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 8-21 amino acids of human Aly/REF export factor
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA324009

USD 380.00

In Stock

Anti-ACIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1065-1080 amino acids of human apoptotic chromatin condensation inducer 1
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA324010

USD 380.00

In Stock

Anti-ACIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1065-1080 amino acids of human apoptotic chromatin condensation inducer 1
CDC5L Rabbit Polyclonal Antibody
TA349625

USD 380.00

In Stock

Rabbit Polyclonal Anti-CDC5L Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDC5L
HNRNPC Rabbit Polyclonal Antibody
TA312153

USD 380.00

In Stock

Rabbit polyclonal hnRNP C1/C2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human hnRNP C1/C2.
TRA2A Rabbit Polyclonal Antibody
TA315400

USD 380.00

In Stock

Rabbit polyclonal anti-TRA-2a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TRA-2a.
hnRNP G (RBMX) Rabbit Polyclonal Antibody
TA350051

USD 380.00

In Stock

Rabbit Polyclonal Anti-RBMX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RBMX
SFRS7 (SRSF7) Rabbit Polyclonal Antibody
TA314524

USD 380.00

In Stock

Rabbit polyclonal anti-SFRS7 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SFRS7.