Antibodies

Jump to Filters
View as table Download
NRG1 Rabbit Polyclonal Antibody
TA351261

USD 380.00

In Stock

Rabbit Polyclonal Anti-NRG1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1
NRG1 Rabbit Polyclonal Antibody
TA311659

USD 380.00

In Stock

Rabbit polyclonal NRG1 isoform-10 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NRG1 isoform-10.
NRG1 (Isoform 10) (N-term) Rabbit Polyclonal Antibody
AP23836PU-N

USD 535.00

2 Weeks

NRG1 (Isoform 10) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated
NRG1 Rabbit Polyclonal Antibody
TA351262

USD 380.00

In Stock

Rabbit Polyclonal Anti-NRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1
NRG1 Rabbit Polyclonal Antibody
TA341924

USD 539.00

5 Days

Rabbit Polyclonal Anti-NRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the N terminal of human NRG1. Synthetic peptide located within the following region: YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS
NRG1 Rabbit Polyclonal Antibody
TA341925

USD 539.00

5 Days

Rabbit Polyclonal Anti-NRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the middle region of human NRG1. Synthetic peptide located within the following region: SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV
NRG1 Rabbit Polyclonal Antibody
TA347403

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-NRG1 isoform-10 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NRG1 isoform-10 Antibody: A synthesized peptide derived from human NRG1 isoform-10