Antibodies

Jump to Filters
View as table Download
B3GAT3 (C-term) Rabbit Polyclonal Antibody
AP50327PU-N

USD 580.00

2 Weeks

B3GAT3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 300-329 amino acids from the C-terminal region of human B3GAT3
B3GAT3 Rabbit Polyclonal Antibody
TA341900

USD 539.00

5 Days

Rabbit Polyclonal Anti-B3GAT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GAT3 antibody: synthetic peptide directed towards the N terminal of human B3GAT3. Synthetic peptide located within the following region: PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY
B3GAT3 Rabbit Polyclonal Antibody
TA361673

USD 539.00

5 Days

B3GAT3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human B3GAT3
B3GAT3 Rabbit Polyclonal Antibody
TA362317

USD 539.00

5 Days

B3GAT3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human B3GAT3