Antibodies

View as table Download

Rabbit Polyclonal Anti-FAM50B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM50B antibody: synthetic peptide directed towards the N terminal of human FAM50B. Synthetic peptide located within the following region: IAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTLNDMKARQEALVRER

Rabbit Polyclonal Anti-FAM50B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM50B antibody: synthetic peptide directed towards the N terminal of human FAM50B. Synthetic peptide located within the following region: EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD

Fam50b Rabbit pAb

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated