Germany
Japan
United Kingdom
China
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Antibodies
View as table Download
Rabbit polyclonal FADS2 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human (Predicted: Bovine, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This FADS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 96-122 amino acids from the Central region of human FADS2. |
USD 380.00
In Stock
Rabbit polyclonal anti-PA2G6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PA2G6. |
Rabbit Polyclonal Anti-PLA2G4E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G4E antibody: synthetic peptide directed towards the c terminal of human PLA2G4E. Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT |
Rabbit Polyclonal c-PLA2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-PLA2 |
Rabbit Polyclonal c-PLA2 (Ser505) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-PLA2 around the phosphorylation site of Serine 505 |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)
| Applications | WB |
| Reactivities | Human (Predicted: Rat, Bovine, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1) |
Rabbit Polyclonal Anti-PLA2G2E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP |
Rabbit Polyclonal Anti-PLA2G5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5. Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC |
Rabbit Polyclonal Anti-PLA2G12B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLA2G12B Antibody is: synthetic peptide directed towards the N-terminal region of Human PLA2G12B. Synthetic peptide located within the following region: LVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELL |
Rabbit Polyclonal Anti-PLA2G2C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G2C antibody is: synthetic peptide directed towards the middle region of Human PLA2G2C. Synthetic peptide located within the following region: LGDKGIPVDDTDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTL |
Rabbit Polyclonal Anti-PLA2G3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLA2G3. Synthetic peptide located within the following region: QRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWS |
Rabbit Polyclonal Anti-PLA2G4B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVD |
Rabbit Polyclonal Anti-ACOX3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT |
Active filters
Reactivities
- Human
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Pathways
- alpha-Linolenic acid metabolism