Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 33 results

Page 1 of 3

(reset)

TNF alpha (TNF) Rabbit Polyclonal Antibody

AP20373PU-N

USD 465.00

3 Weeks

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

1 / 2

2 / 2

Previous Next

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

TA329505

USD 485.00

5 Days

Rabbit Polyclonal anti-GNAS antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody

TA313319

USD 380.00

4 Weeks

Rabbit polyclonal anti-TGF Beta1 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA336738

USD 605.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications	FC, ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

TA308888

USD 625.00

5 Days

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications	IHC, WB
Reactivities	Human, Mouse (Predicted: Dog, Pig, Bovine)
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2)

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

TA323637

USD 380.00

In Stock

Anti-GNAS Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus

1 / 3

2 / 3

3 / 3

Previous Next

TGF beta 1 (TGFB1) (N-term) Rabbit Polyclonal Antibody

AP54230PU-N

USD 580.00

2 Weeks

TGF beta 1 (TGFB1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of Human TGFB1.

1 / 3

2 / 3

3 / 3

Previous Next

IGF1 Rabbit Polyclonal Antibody

PP1020P2

USD 465.00

2 Weeks

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)

1 / 2

2 / 2

Previous Next

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

TA308889

USD 535.00

In Stock

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications	IHC, WB
Reactivities	Human, Mouse (Predicted: Rat, Dog, Pig, Bovine)
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2)

1 / 3

2 / 3

3 / 3

Previous Next

TGF beta 2 (TGFB2) Rabbit Polyclonal Antibody

TA356540

USD 539.00

5 Days

TGFB2 Antibody - middle region

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human TGFB2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

TA323636

USD 380.00

2 Weeks

Anti-GNAS Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA319289

USD 1,795.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications	IHC, WB
Reactivities	Human, Primate
Conjugation	Unconjugated
Immunogen	The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA319290

USD 1,795.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

1 / 3

2 / 3

3 / 3

Previous Next

TGF beta 3 (TGFB3) Rabbit Polyclonal Antibody

TA325932

USD 380.00

4 Weeks

Rabbit Polyclonal TGFβ3 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3.

1 / 2

2 / 2

Previous Next

IGF1 Rabbit Polyclonal Antibody

PP1020P1

USD 345.00

2 Weeks

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)

1 / 2

2 / 2

Previous Next

1 - 15 of 33 results

Page 1 of 3