Antibodies

View as table Download

Rabbit polyclonal Connexin 43 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Connexin 43.

Rabbit Polyclonal Anti-Connexin-43

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HAQPFDFPDDNQNSK, corresponding to amino acids residues 331-345 of human Connexin-43. Intracellular, C-terminus.

Anti-GJD2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 157-175 amino acids of Human gap junction protein, delta 2, 36kDa

GJA1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide mapping at the C-terminus of human Connexin 43

GJA1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GJA1 pSer367 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Connexin 43 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Connexin 43.

Rabbit Polyclonal Anti-GJD2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJD2 antibody: synthetic peptide directed towards the middle region of human GJD2. Synthetic peptide located within the following region: ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY

Anti-GJA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 232-382 amino acids of human gap junction protein, alpha 1, 43kDa

Rabbit Polyclonal Connexin 43 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Connexin 43

Rabbit Polyclonal Connexin 43 (Ser367) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Connexin 43 around the phosphorylation site of Serine 367
Modifications Phospho-specific

Rabbit Polyclonal Anti-GJD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CX36 antibody: synthetic peptide directed towards the middle region of human CX36. Synthetic peptide located within the following region: NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA

Rabbit Polyclonal Anti-Connexin 43 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Connexin 43 Antibody: A synthesized peptide derived from human Connexin 43

Rabbit polyclonal Connexin 43 (Ser265) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Connexin 43 around the phosphorylation site of Serine 265.
Modifications Phospho-specific