Antibodies

Jump to Filters
View as table Download
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA336911

USD 550.00

5 Days

Rabbit Polyclonal PPAR gamma/NR1C3 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human PPAR gamma protein (between residues 20-120) [UniProt P37231]
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA347270

USD 580.00

5 Days

Rabbit Polyclonal PPARG Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein.
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA331938

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPARG Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPARG Antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA327865

USD 380.00

In Stock

Rabbit Polyclonal PPAR-gamma Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PPAR-gamma
PPAR gamma (PPARG) Rabbit Polyclonal Antibody
TA327806

USD 380.00

4 Weeks

Rabbit Polyclonal Phospho-PPAR- gamma (Ser112) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PPAR- gamma around the phosphorylation site of Serine 112
Modifications Phospho-specific