Antibodies

Jump to Filters
View as table Download
ASS1 Rabbit Polyclonal Antibody
TA308171

USD 625.00

In Stock

Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 198 of ASS1 (Uniprot ID#P00966)
ASS1 (C-term) Rabbit Polyclonal Antibody
AP50278PU-N

USD 580.00

2 Weeks

ASS1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 280-310 amino acids from the C-terminal region of human ASS1
ASS1 Rabbit Polyclonal Antibody
TA346025

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the C terminal of human ASS. Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE
ASS1 Rabbit Polyclonal Antibody
TA346024

USD 485.00

5 Days

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the N terminal of human ASS. Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
ASS1 (Center) Rabbit Polyclonal Antibody
AP17139PU-N

USD 580.00

2 Weeks

ASS1 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human ASS